Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2aqw

2aqw (red) and 1eix (white)

PDBID: 2aqw

Motif: 1eix

EC # of Motif: 4.1.1.23
 
Motif Homolog: 1dbt

Levenshtein Distance: 1

RMSD All: 0.511 Å

RMSD CA0.11894 Å

RMSD CA+CB0.32293 Å

Residues: (3)

 2aqw1eix 
Lys-105  Lys-44
Asp-139 Asp-71 
Lys-141  Lys-73
  Asp-76


2aqw FATSA: 
    MHFKTKLKNRRSEVNTCLCIGLDPDEDDIKNFMKNEEQNGYKNIKNNMNSNNNGIENIIKIGKEILLTDGENIQ
    NLSEEDKFFYFFNHFCFYIINNTKEYALVYKMNFAFYIPYGSVGINALKNVFDYLNSMNIPTMLDMKINDIGNTV
    KNYRKFIFEYLKSDSCTINVYMGTNMLKDICFDYEKNKYYSAYVLIKTTNKDSFIFQNELSINDKQAYIVMADET
    QKMATELKIEQNNEFIGFVVGSNAFEEMKIIRNKFPDSYILSPGIGAQNGDLYKTLKNGYNKDYEKLLINVGRAIT
    KSPDPKKSSESYYNQIIQIFKDIENGDNIEQV