Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1z40

1z40 (red) and 1zrz (white)

PDBID: 1z40

Motif: 1zrz

EC # of Motif: 2.7.11.13
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 2.182689 Å

RMSD CA1.576506 Å

RMSD CA+CB1.41744 Å

Residues: (3)

1z40 1zrz 
Asp-227 Asp-369 
Lys-368 Lys-371 
Asn-369 Asn-374 

1z40 FASTA:
    GNYMGNPWTEYMAKYDIEEVHGSGIRVDLGEDAEVAGTQYRLPSGKCPVFGKGIIIENSNTTFLTPVATGNQ
    YLKDGGFAFPPTEPLMSPMTLDEMRHFYKDNKYVKNLDELTLCSRHAGNMIPDNDKNSNYKYPAVYDDKD
    KKCHILYIAAQENNGPRYCNKDESKRNSMFCFRPAKDISFQNYTYLSKNVVDNWEKVCPRKNLQNAKFGLW
    VDGNCEDIPHVNEFPAIDLFECNKLVFELSASDQPKQYEQHLTDYEKIKEGFKNKNASMIKSAFLPTGAFKAD
    RYKSHGKGYNWGNYNTETQKCEIFNVKPTCLINNSSYIATTALSHPIEVE