Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1yx3

1yx3 (red) and 1cns (white)

PDBID: 1yx3

Motif: 1cns

EC # of Motif: 3.2.1.14
 
Motif Homolog: 1ctn, 1itx, 1myr, 2dbt

Levenshtein Distance: 0

RMSD All: 2.2063004 Å

RMSD CA0.778269 Å

RMSD CA+CB1.22253 Å

Residues: (3)

 1yx3 1cns
 Glu-41Clu-67 
Glu-45 Glu-89 
Ser-89 Ser-120 


1yx3 FASTA:
    MGSSHHHHHHSSGLVPRGSHMADTIEVDGKQFAVDEEGYLSNLNDWVPGVADVMAKQDNLELTEEHWDIINFL
    REYYEEYQIAPAVRVLTKAVGKKLGKEKGNSKYLYSLFPYGPAKQACRFAGLPKPTGCV