Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1yre

1yre (red) and 1fwa (white)

PDBID: 1yre

Motif: 1fwa

EC # of Motif: 3.5.1.5
 
Motif Homolog:  1nba, 1pqs

Levenshtein Distance: 1-3

RMSD All: 2.527107 Å

RMSD CA: 1.5982 Å

RMSD CA+CB: 1.974799 Å

Residues: (3)

 1yre1fwa
 Chain A Chain C
 Asp-179 His-219
 His-180 Asp-221
Chain DChain C
 His-320 
 Arg-168 Arg-336


1yre (red) and 1kra (white)


Motif: 1kra

EC # of Motif: 3.5.1.5
 
Motif Homolog: 1nba, 1pqs

Levenshtein Distance: 1-3

RMSD All: N/A Å

RMSD CA1.89229 Å

RMSD CA+CB1.53795 Å

Residues: (3)

 1yre 1kra
 Chain AChain C
Asp-179His-219
His-180  Asp-221
Chain DChain C
 His-320 
Arg-168 Arg-336 

1yre FASTA: 
    GHMSRRAPMFKPLPITLQRGALRLEPLVEADIPELVSLAEANREALQYMDGPTRPDWYRQSLAEQREGRALPLAVR
    LGVQLVGTTRFAEFLPALPACEIGWTWLDQAQHGSGLNRMIKYLMLKHAFDNLRMVRVQLSTAASNLRAQGAI
    DKLGAQREGVLRNHRRLAGGRLDDTFVYSITDHEWPQVKAALEASFTG