Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1yey

1yey (red) and 1k9z (white)

PDBID: 1yey

Motif: 1k9z

EC # of Motif: 3.1.3.7
 
Motif Homolog: 1qgx

Levenshtein Distance: 0-9

RMSD All: 2.21854 Å

RMSD CA: 0.95247 Å

RMSD CA+CB: 0.76764 Å

Residues: (3)
 1yey1k9z
 Lys-32 
 Asp-78Asp-49
  Glu-72
 Thr-373Thr-147
Asp-378Asp-294



1yey (red) and 2dnj (white)

PDBID: 1yey

Motif: 2dnj

EC # of Motif: 3.1.21.1
 
Motif Homolog: 1dnk 

Levenshtein Distance: 1-13

RMSD All: 3.98241 Å

RMSD CA: 3.28501 Å

RMSD CA+CB: 3.184 Å

Residues: (4)
 1yey1dnj
Glu-78 Glu-301 
His-134His-351
 Asp-212Glu-359
His-252His-388

1yey FASTA: 
    GSHMRTIIALETHDVRFPTSRELDGSDAMNPDPDYSAAYVVLRTDGAEDLAGYGLVFTIGRGNDVQTAAVAALAEHVVGL
    SVDKVIADLGAFARRLTNDSQLRWLGPEKGVMHMAIGAVINAAWDLAARAANKPLWRFIAELTPEQLVDTIDFRYLSDAL
    TRDEALAILRDAQPQRAARTATLIEQGYPAYTTSPGWLGYSDEKLVRLAKEAVADGFRTIKLKVGANVQDDIRRCRLARA
    AIGPDIAMAVDANQRWDVGPAIDWMRQLAEFDIAWIEEPTSPDDVLGHAAIRQGITPVPVSTGEHTQNRVVFKQLLQAGA
    VDLIQIDAARVGGVNENLAILLLAAKFGVRVFPHAGGVGLCELVQHLAMADFVAITGKMEDRAIEFVDHLHQHFLDPVRI
    QHGRYLAPEVPGFSAEMHPASIAEFSYPDGRFWVEDLAASKAKA