Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1yem


PDBID: 1yem

Motif: 1cnz

EC # of Motif: 1.1.1.85
 
Motif Homolog: 1a05

Levenshtein Distance: 0

RMSD All: 1.236353 Å

RMSD CA: 1.66767 Å

RMSD CA+CB: 1.52685 Å

Residues: (3)
 1yem1cnz
 Lys-6Lys-195
 Asp-125Asp-227
 Tyr-159Tyr-145 
                                                        1yem (red) and 1cnz (white)



1yem FASTA: 
    MHHHHHHGSEVEIKFKIKLEDFLHTLNTFNPEFVRYEEQEDVYFEVPRPKLLRIRGVHNLKKYYLTFKEILDENNE
    EFYEVEFEIGDFEKAVEVFKRLGFKIQATIKKKRWVYKLNGVTLEVNRVEGIGDFVDIEVISDSPEEAKEKIWEVA
    KMLGLKEEDVEPRLYLELINELSGRSS