Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1vqw

1vqw (red) and 1aw5 (white)
PDBID: 1vqw

Motif: 1aw5

EC # of Motif: 4.2.1.24
 
Motif Homolog: 1h7o

Levenshtein Distance: 1-2

RMSD All: 1.26966 Å

RMSD CA: 0.80536 Å

RMSD CA+CB: 1.02307 Å

Residues: (3)
 1vqw1aw5 
 Asp-140Asp-131
 Ser-298Ser-179
 Lys-301Lys-210 
 Lys-263 

1r3d FASTA: 
MSLCLPTIRKIAIIGAGPSGLVTAKALLAEKAFDQVTLFERRGSPGGVWNYTSTLSNKLPVPSTNPILTTEPIVGPAALP
VYPSPLYRDLQTNTPIELMGYCDQSFKPQTLQFPHRHTIQEYQRIYAQPLLPFIKLATDVLDIEKKDGSWVVTYKGTKAG
SPISKDIFDAVSICNGHYEVPYIPNIKGLDEYAKAVPGSVLHSSLFREPELFVGESVLVVGGASSANDLVRHLTPVAKHP
IYQSLLGGGDIQNESLQQVPEITKFDPTTREIYLKGGKVLSNIDRVIYCTGYLYSVPFPSLAKLKSPETKLIDDGSHVHN
VYQHIFYIPDPTLAFVGLALHVVPFPTSQAQAAFLARVWSGRLKLPSKEEQLKWQDELMFSLSGANNMYHSLDYPKDATY
INKLHDWCKQATPVLEEEFPSPYWGEKERSIRENMWSIRAKFFGIEPPKEGHHHHHH