Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1r3d

1r3d (red) and 3lip (white)

PDBID: 1r3d

Motif: 3lip

EC # of Motif: 3.1.1.3
 
Motif Homologs: 1hpl, 2lip, 1r4z, 1gd6, 1tah, 1thq

Levenshtein Distance: 0

RMSD All: 0.896 Å

RMSD CA: 0.7689 Å

RMSD CA+CB: 0.6981 Å

Residues: (3) 
 1r3d3lip 
  Leu-17
 Ser-91Ser-87 
 Gln-88 
 Asp-218Asp-254 
 His-240His-286 

1r3d FASTA: 
        SLLSNQLHFAKPTARTPLVVLVHGLLGSGADWQPVLSHLARTQCAALTLDLPGHGTNPERHCDNFAEAVEMIEQTV
        QAHVTSEVPVILVGYSLGGRLIMHGLAQGAFSRLNLRGAIIEGGHFGLQENEEKAARWQHDQQWAQRFSQQPIEH
        VLSDWYQQAVFSSLNHEQRQTLIAQRSANLGSSVAHMLLATSLAKQPYLLPALQALKLPIHYVCGEQDSKFQQLAE
        SSGLSYSQVAQAGHNVHHEQPQAFAKIVQAMIHSIID