Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1oq1

1oq1 (red) and 1e2t (white)

PDBID: 1oq1

Motif: 1e2t

EC # of Motif: 2.31.118
 
Motif Homolog: N/A

Levenshtein Distance: 0-2

RMSD All: 1.94287 Å

RMSD CA: 0.705418 Å

RMSD CA+CB: 1.05493 Å

Residues: (3)
 1oq11e2t 
 Cys-7Cys-69 
 His-215His-107 
Asp-155Asp-122 




1oq1 (red) and 1qam (white)
PDBID:1oq1

Motif: 1qam

EC # of Motif: 2.1.1.184
 
Motif Homolog: N/A

Levenshtein Distance: 0-9

RMSD All: N/A

RMSD CA: 0.82324 Å

RMSD CA+CB: 1.07843 Å

Residues:(3) 
 1oq11qam 
 Gly-83Gly-38 
 Glu-87Glu-59
 Asn-119Asn-101 

1oq1 FASTA:
        SNAMYKEGACLYRNPLRSKSDVKDWRMEGGGQISFDDHSLHLSHVQDEAHFVFWCPETFPDGIIVTWDFSPIEQPGLCML
       FFAAAGIRGEDLFDPSLRKRTGTYPEYHSGDINALHLSYFRRKYAEERAFRTCNLRKSRGFHLAAMGADPLPSPDDADSPYR
        MKLIKDKGYVHFSINGLPILEWMDDGSTYGPVLTKGKIGFRQMAPMKAVYRDFAVHQAVRR