Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1nog


PDBID: 1nog

Motif: 1mbb

EC # of Motif: 1.1.1.158
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 1.92966 Å

RMSD CA: 0.92663Å

RMSD CA+CB: 1.10495 Å

Residues: (3)  

 1nog1mbb 
 Arg-47Arg-159 
 Ser-109Ser-229 
 Glu-111Glu-325 
                                          
                                                  1nog (red) and 1mbb (white)


1nog FASTA:
        MFTRRGDQGETDLANRARVGKDSPVVEVQGTIDELNSFIGYALVLSRWDDIRNDLFRIQNDLFVLGEDVSTG
        GKGRTVTREMIDYLEARVKEMKAEIGKIELFVVPGGSVESASLHMARAVSRRLERRIVAASKLTEINKNVLIY
        ANRLSSILFMHALISNKRLNIPEKIWSIHRVS