Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1mk4

1mk4 (red) and 1gy0 (white)
PDBID: 1mk4

Motif: 1gy0

EC # of Motif: 2.4.2.31
 
Motif Homolog: 1og1

Levenshtein Distance: 0

RMSD All: 3.5783 Å

RMSD CA: 2.3767 Å

RMSD CA+CB: 2.17147 Å

Residues: (4)  
 1mk41gy0 
 Ser-8Ser-147 
Glu-12Glu-159 
 Arg-33Arg-184 
 Glu-37Glu-189 

1mk4 FASTA:
        HMDIRTITSSDYEMVTSVLNEWWGGRQLKEKLPRLFFEHFQDTSFITSEHNSMTGFLIGFQSQSDPETAYIHFSGVHPD
        FRKMQIGKQLYDVFIETVKQRGCTRVKCVTSPVNKVSIAYHTKLGFDIEKGTKTVNGISVFANYDGPGQDRVLFVKNI