Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1kuu

1kuu (red) aligned with 1bg4 (white)
PDBID: 1kuu

Motif: 1bg4

EC # of Motif: 3.2.1.8
 
Motif Homolog: 1bvv

Levenshtein Distance: 0-3

RMSD All: 3.0594 Å

RMSD CA: 3.06406 Å

RMSD CA+CB: 2.757999 Å

Residues: (4)  
                  
 1kuu1bg4 
 Glu-45Glu-132 
His-47His-210 
 Glu-48Glu-238 
 Asp-50Asp-240 


1kuu FASTA:
       MYLGRILAVGRNSNGSFVAYRVSSRSFPNRTTSIQEERVAVVPVEGHERDVFRNPYIAYNCIRIVGDTAVVSNGSH
        TDTIADKVALGMNLRDAIGLSLLAMYEKDELNTPRIAAAINGSEAFIGIVTADGLMVSRVPEETPVYISTYEQTEPAAT
        EFKAGSPEEAAEFILKGGEFAAFTHPVTAAAAFNDGEGWNLATREM

Comments