Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1k77

PDBID: 1k77

Motif: 1ryb

EC # of Motif: 3.1.1.29
 
Motif Homolog: 2pth

Levenshtein Distance: 0-2

RMSD All: 1.914 Å

RMSD CA: 1.211 Å

RMSD CA+CB: 1.3302 Å

Residues: (3)
1k77 1ryb 
 Asn-188Asn-11 
 His-191His-201
 Asp-195Asp-93 
                                        1k77 (red) and 1ryb (white)





Motif: 2pth

EC # of Motif: 3.1.1.29
 
Motif Homolog: N/A

Levenshtein Distance: 0-2

RMSD All: 2.093 Å

RMSD CA: 1.18453 Å

RMSD CA+CB: 1.29988 Å

Residues: (3)

 1k77 2pth
 Asn-188Asn-10 
 His-191His-20 
 Asp-195Asp-93 
                                            1k77 (red) and 2pth (white)


1k77 FASTA:
    MPRFAANLSMMFTEVPFIERFAAARKAGFDAVEFLFPYNYSTLQIQKQLEQNHLTLALFNTAPGDINAGEWGLSA
    LPGREHEAHADIDLALEYALALNCEQVHVMAGVVPAGEDAERYRAVFIDNIRYAADRFAPHGKRILVEALSPGVK
    PHYLFSSQYQALAIVEEVARDNVFIQLDTFHAQKVDGNLTHLIRDYAGKYAHVQIAGLPDRHEPDDGEINYPWLF
    RLFDEVGYQGWIGCEYKPRGLTEEGLGWFDAWRGS