Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1jzt

        PDBID: 1jzt

        Motif: 1ghr

        EC # of Motif: 3.2.1.73
 
        Motif Homolog: 1aq02ayh

        Levenshtein Distance: 1-3 

        RMSD All: 1.694 Å

        RMSD CA1.322886 Å

        RMSD CA+CB1.54747 Å

        Residues: (3)     

 1jzt1ghr 
 Glu-232 
 Glu-126Glu-280 
 Lys-129 Lys-283
 Glu-131 Glu-288
                            1jzt (red) and 1ghr (white)


1jzt FASTA: 
    MSTLKVVSSKLAAEIDKELMGPQIGFTLQQLMELAGFSVAQAVCRQFPLRGKTETEKGKHVFVIAGPGNNGGD
    GLVCARHLKLFGYNPVVFYPKRSERTEFYKQLVHQLNFFKVPVLSQDEGNWLEYLKPEKTLCIVDAIFGFSFKPP
    MREPFKGIVEELCKVQNIIPIVSVDVPTGWDVDKGPISQPSINPAVLVSLTVPKPCSSHIRENQTTHYVGGRFIPR
    DFANKFGFEPFGYESTDQILKL