Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1jov

PDBID: 1jov

Motif: 1ryb

EC # of Motif: 3.1.1.29
 
Motif Homolog: 2pth

Levenshtein Distance: 0-2

RMSD All: 2.293 Å

RMSD CA1.483299 Å

RMSD CA+CB1.34474 Å

Residues: (3)

 1jov1ryb
Gln-201Asn-11
 His-216His-21
Glu-265Asp-93
                                                    
                                                1jov (red) and 1ryb (white)

1jov FASTA: 
    MKTTLLKTLTPELHLVQHNDIPVLHLKHAVGTAKISLQGAQLISWKPQNAKQDVLWLSEVEPFKNGNAIR
    GGVPICYPWFGGVKQPAHGTARIRLWQLSHYYISVHKVRLEFELFSDLNIIEAKVSMVFTDKCHLTFTHYG
    EESAQAALHTYFNIGDINQVEVQGLPETCFNSLNQQQENVPSPRHISENVDCIYSAENMQNQILDKSFNR
    TIALHHHNASQFVLWNPWHKKTSGMSETGYQKMLCLETARIHHLLEFGESLSVEISLKG