Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

1iuy


PDBID: 1iuy        
Motif: 1nhc                             
EC # of Motif: 3.2.1.15                         
Motif Homolog: 1czf                         
Levenshtein Distance: 0                         
RMSD All: 1.934 Å                    
RMSD CA: 1.64298  Å                    
RMSD CA+CB: 1.5575  Å

Residues: (4)

 1iuy1czf 
 Asp-20Asp-186 
 Asp-21 Asp-207
 Asp-22Asp-208 
 His-25His-229 





                                    1iuy (red) aligned with 1nhc (white)

1iuy FASTA:
    MAAKQGESDPERKETRQKVDDDRKHEIEAAIVRIMKSRKKMQHNVLVAEVTQQLKARFLPSPVVIKKRIEGLIEREYLARTPEDRKVYTYVA