Home‎ > ‎Good Hit Proteins‎ > ‎PDB‎ > ‎

2daf

2daf (red) and 1azw (white)

PDBID: 2daf

Motif: 1azw

EC # of Motif: 3.4.11.5
 
Motif Homolog: 1xqw

Levenshtein Distance: 0

RMSD All: 2.66616 Å

RMSD CA: 1.580677 Å

RMSD CA+CB: 1.509359 Å

Residues: (3)

 2daf 1azw
 Ser-2Ser-110
 Asp-44Asp-266 
His-48 His-29


2daf (red) and 1c4x (white)

Motif: 1c4x

EC # of Motif: 3.7.1.8
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 2.66059 Å

RMSD CA: 1.51619 Å

RMSD CA+CB: 1.473109 Å

Residues: (3)

 2daf1c4x 
 Ser-2 Ser-110
 Asp-44 Asp-235
 His-48 His-263




Motif: 1ysc

EC # of Motif: 3.4.16.5
 
Motif Homolog: N/A

Levenshtein Distance: 0

RMSD All: 2.803155 Å

RMSD CA: 1.66891 Å

RMSD CA+CB: 1.572205 Å

Residues: (3)

 2daf1ysc 
 Ser-2 Ser-146
 Asp-44 Asp-338
 His-48 His-397


2daf FASTA:
     GSSGSSGQESVEDSLATVKVVLIPVGQEIVIPFKVDTILKYLKDHFSHLLGIPHSVLQIRYSGKILKNNE
    TLVQHGVKPQEIVQVEIFSTNPDLYPVRRIDGLTDVSQIITVSGPSSG